TESMORELIN

Product Name:

Tesmorelin (Growth Hormone-Releasing Hormone Analog)

Chemical Information:

• Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S
• Molecular Weight: 5195.9 g/mol
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
• Molecular Structure:

Product Description:

Tesmorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH) and is commonly utilized in biochemical and molecular research involving peptide–receptor interactions and signaling pathway analysis. In controlled laboratory settings, it is studied for its interaction with growth hormone-releasing hormone receptors (GHRH-R) and its role in intracellular signaling mechanisms within endocrine research models under defined in vitro conditions. This material is supplied in lyophilized powder form and is intended strictly for in vitro research and analytical applications.

Research Applications:

Tesmorelin is utilized in controlled research environments to support investigation of:

• Growth hormone-releasing hormone receptor (GHRH-R) binding and signaling pathway analysis in isolated cell-based or cell-free in vitro assay systems
• Peptide–receptor interaction dynamics in endocrine signaling models
• Intracellular signaling cascade evaluation associated with peptide ligands
• Structure-function relationships of GHRH-derived peptide analogs
• Stability, degradation, and analytical profiling in assay-based systems

All research applications are conducted in non-human, non-clinical experimental settings.

Storage and Handling:

• Store lyophilized material at −20°C (−4°F)
• After reconstitution, store at 2–8°C (36–46°F) and use promptly
• Avoid repeated freeze-thaw cycles
• Maintain aseptic laboratory handling procedures

Product Specifications:

• Purity: ≥99% (HPLC Certified)
• Appearance: Lyophilized white powder
• Solubility: Soluble in suitable laboratory agents

Compliance Notice:

Tesmorelin is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.

Product Usage: Not for Human or Veterinary Use

Pure Health Peptides products are supplied to qualified research professionals and institutional users for in vitro laboratory research only. KYC verification is required prior to order fulfillment, and we reserve the right to refuse orders that do not meet buyer qualification criteria. These products are not drugs, foods, cosmetics, diagnostic products, or dietary supplements, have not been evaluated by the FDA, and are not intended for human or animal use. Any such use is prohibited and may violate federal, state, or local law. By purchasing, the buyer represents and warrants that the product will be used solely for in vitro research. The buyer agrees to indemnify, defend, and hold harmless Pure Health Peptides, its officers, employees, and agents from and against any and all claims, damages, losses, liabilities, costs, and expenses (including reasonable attorneys fees) arising out of or relating to the buyer’s use, handling, storage, or disposition of the product in any manner inconsistent with its research-use-only designation or applicable law.