FOXO4-DRI

Product Name:

FOXO4-DRI (FOXO4 D-Retro-Inverso)

Chemical Information:

• Molecular Formula: C₂₂₈H₃₈₈N₈₆O₆₄
• Molecular Weight: ~5358 g/mol
• Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP (D-amino acids; retro-inverso)
• Structure Class: Synthetic peptide (D-retro-inverso configuration)

Molecular Structure:

Product Description:

FOXO4-DRI (FOXO4 D-Retro-Inverso) is a synthetic peptide engineered in a D-retro-inverso configuration based on a defined peptide sequence. The retro-inverso design and D-residue composition are utilized in research to examine peptide stability and interaction characteristics in vitro. Supplied as a lyophilized powder, FOXO4-DRI is intended strictly for controlled laboratory research.

Research Applications:

FOXO4-DRI is utilized in controlled laboratory research settings for applications such as:

• Evaluation of D-retro-inverso peptide behavior in stability and interaction assays
• Investigation of peptide–protein binding interactions in defined assay systems
• Comparative analysis of L- and D-configured peptide structures under controlled conditions
• Development of in vitro assay systems for studying peptide interaction characteristics

Storage and Handling:

• Store lyophilized powder at −20 °C until use
• Once reconstituted, store at 2–8 °C and use promptly
• Maintain aseptic technique during handling

Product Specifications:

• Purity: ≥99% (HPLC/LC-MS Verified)
• Appearance: Lyophilized white powder
• Solubility: Soluble in suitable laboratory agents

Compliance Notice:

FOXO4-DRI is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.

Product Usage: Not for Human or Veterinary Use

Pure Health Peptides products are supplied to qualified research professionals and institutional users for in vitro laboratory research only. KYC verification is required prior to order fulfillment, and we reserve the right to refuse orders that do not meet buyer qualification criteria. These products are not drugs, foods, cosmetics, diagnostic products, or dietary supplements, have not been evaluated by the FDA, and are not intended for human or animal use. Any such use is prohibited and may violate federal, state, or local law. By purchasing, the buyer represents and warrants that the product will be used solely for in vitro research. The buyer agrees to indemnify, defend, and hold harmless Pure Health Peptides, its officers, employees, and agents from and against any and all claims, damages, losses, liabilities, costs, and expenses (including reasonable attorneys fees) arising out of or relating to the buyer’s use, handling, storage, or disposition of the product in any manner inconsistent with its research-use-only designation or applicable law.